Lineage for d1autc_ (1aut C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1793432Protein Activated protein c (autoprothrombin IIa) [50579] (1 species)
  7. 1793433Species Human (Homo sapiens) [TaxId:9606] [50580] (2 PDB entries)
  8. 1793434Domain d1autc_: 1aut C: [26348]
    Other proteins in same PDB: d1autl1, d1autl2
    complexed with 0g6

Details for d1autc_

PDB Entry: 1aut (more details), 2.8 Å

PDB Description: Human activated protein C
PDB Compounds: (C:) activated protein c

SCOPe Domain Sequences for d1autc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}
lidgkmtrrgdspwqvvlldskkklacgavlihpswvltaahcmdeskkllvrlgeydlr
rwekweldldikevfvhpnysksttdndiallhlaqpatlsqtivpiclpdsglaereln
qagqetlvtgwgyhssrekeakrnrtfvlnfikipvvphnecsevmsnmvsenmlcagil
gdrqdacegdsggpmvasfhgtwflvglvswgegcgllhnygvytkvsryldwihghird

SCOPe Domain Coordinates for d1autc_:

Click to download the PDB-style file with coordinates for d1autc_.
(The format of our PDB-style files is described here.)

Timeline for d1autc_: