Lineage for d1akea1 (1ake A:1-121,A:157-214)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123299Protein Adenylate kinase [52554] (16 species)
  7. 2123323Species Escherichia coli [TaxId:562] [52560] (8 PDB entries)
    contains a rudiment "zinc-finger" subdomain, residue 122-156
  8. 2123330Domain d1akea1: 1ake A:1-121,A:157-214 [31905]
    Other proteins in same PDB: d1akea2, d1akeb2
    complexed with ap5

Details for d1akea1

PDB Entry: 1ake (more details), 2 Å

PDB Description: structure of the complex between adenylate kinase from escherichia coli and the inhibitor ap5a refined at 1.9 angstroms resolution: a model for a catalytic transition state
PDB Compounds: (A:) adenylate kinase

SCOPe Domain Sequences for d1akea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akea1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}
mriillgapgagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
vXkddqeetvrkrlveyhqmtapligyyskeaeagntkyakvdgtkpvaevradlekilg

SCOPe Domain Coordinates for d1akea1:

Click to download the PDB-style file with coordinates for d1akea1.
(The format of our PDB-style files is described here.)

Timeline for d1akea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1akea2