Class a: All alpha proteins [46456] (289 folds) |
Fold a.61: Retroviral matrix proteins [47835] (1 superfamily) 4-5 helices; right-handed superhelix |
Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) the 5th, C-terminal helix is missing in some of the member structures |
Family a.61.1.4: GAG polyprotein M-domain [47848] (2 proteins) the C-terminal helix region is missing(?) automatically mapped to Pfam PF02813 |
Protein GAG polyprotein M-domain [47849] (1 species) |
Species Rous sarcoma virus [TaxId:11886] [47850] (1 PDB entry) |
Domain d1a6sa_: 1a6s A: [18134] |
PDB Entry: 1a6s (more details)
SCOPe Domain Sequences for d1a6sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6sa_ a.61.1.4 (A:) GAG polyprotein M-domain {Rous sarcoma virus [TaxId: 11886]} geavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaalsq ramilgksgelktwglvlgalkaaree
Timeline for d1a6sa_: