PDB entry 7rp2

View 7rp2 on RCSB PDB site
Description: Crystal structure of Kas G12C in complex with 2H11 CLAMP
Class: Hydrolase/Immune System
Keywords: GTPase, antibody, conformation-specific, Hydrolase-Immune System complex
Deposited on 2021-08-03, released 2022-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-03-16, with a file datestamp of 2022-03-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • expression tag (0)
      • engineered mutation (12)
      • engineered mutation (51)
      • engineered mutation (80)
      • engineered mutation (118)
    Domains in SCOPe 2.08: d7rp2a1, d7rp2a2
  • Chain 'H':
    Compound: immunoglobulin IgG heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7RP2 (0-225)
  • Chain 'I':
    Compound: immunoglobulin IgG light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 7RP2 (0-214)
    Domains in SCOPe 2.08: d7rp2i1, d7rp2i2
  • Heterogens: GDP, MG, CAC, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7rp2A (A:)
gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
gqeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7rp2I (I:)
svltqppsasgtpgqrvtiscsgsssnigsnyvywyqqlpgtapklliyrnnqrpsgvpd
rfsgsksgtsaslaisglrsedeadyycaawderlsgwvfgggtkltvlgqpkaapsvtl
fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
lsltpeqwkshrsyscqvthegstvektvaptecs