PDB entry 7npc

View 7npc on RCSB PDB site
Description: ROR(gamma)t ligand binding domain in complex with allosteric ligand FM156
Class: nuclear protein
Keywords: Nuclear Receptor, Allosteric, Inverse Agonist, Inhibitor, NUCLEAR PROTEIN
Deposited on 2021-02-26, released 2021-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-06-02, with a file datestamp of 2021-05-28.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (0-239)
      • conflict (187)
    Domains in SCOPe 2.07: d7npca_
  • Heterogens: ULT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7npcA (A:)
teiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhltea
iqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggmel
fralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynle
lafhhhlhkthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplykelfs