Lineage for d7npca_ (7npc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2343011Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2343012Protein automated matches [191142] (6 species)
    not a true protein
  7. 2343025Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)
  8. 2343028Domain d7npca_: 7npc A: [406038]
    automated match to d5c4ta_
    complexed with gol, ult

Details for d7npca_

PDB Entry: 7npc (more details), 1.47 Å

PDB Description: ror(gamma)t ligand binding domain in complex with allosteric ligand fm156
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d7npca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7npca_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhltea
iqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggmel
fralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynle
lafhhhlhkthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplykelfs

SCOPe Domain Coordinates for d7npca_:

Click to download the PDB-style file with coordinates for d7npca_.
(The format of our PDB-style files is described here.)

Timeline for d7npca_: