PDB entry 7lz5

View 7lz5 on RCSB PDB site
Description: Crystal structure of oncogenic KRAS Q61E GMPPCP-bound
Class: oncoprotein
Keywords: oncogenic, active state, ONCOPROTEIN
Deposited on 2021-03-09, released 2022-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-03-16, with a file datestamp of 2022-03-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoform 2B of GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116-2 (0-163)
      • engineered mutation (60)
      • engineered mutation (117)
      • expression tag (164-168)
    Domains in SCOPe 2.08: d7lz5a1, d7lz5a2
  • Heterogens: GCP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7lz5A (A:)
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
eeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek