PDB entry 7d3z

View 7d3z on RCSB PDB site
Description: X-ray crystal Structure of E.coli Dihydrofolate Reductase complexed with folate and NADP+ at pH4.5
Class: oxidoreductase
Keywords: dihydrofolate, reductase, alpha-beta sandiwitch, NADPH, OXIDOREDUCTASE
Deposited on 2020-09-21, released 2021-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-09, with a file datestamp of 2021-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Escherichia coli (strain K12) [TaxId:83333]
  Gene: folA, tmrA, b0048, JW0047
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABQ4 (0-158)
    • conflict (36)
  Domains in SCOPe 2.08: d7d3za_
• Heterogens: FOL, NAP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7d3zA (A:)
  misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
  ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
  gdthfpdyepddwesvfsefhdadaqnshsycfeilerr