PDB entry 7bu6

View 7bu6 on RCSB PDB site
Description: Structure of human beta1 adrenergic receptor bound to norepinephrine and nanobody 6B9
Class: membrane protein
Keywords: G protein coupled receptor, membrane protein
Deposited on 2020-04-04, released 2020-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-12, with a file datestamp of 2021-05-07.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endolysin,Endolysin,Endolysin,Beta-1 adrenergic receptor chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: ADRB1, ADRB1R, B1AR
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9IEF7 (8-167)
      • expression tag (0-7)
      • engineered mutation (60)
      • engineered mutation (103)
      • linker (168-169)
    • PDB 7BU6 (170-End)
  • Chain 'B':
    Compound: Camelid Antibody Fragment
    Species: Camelidae mixed library [TaxId:1579311]
    Database cross-references and differences (RAF-indexed):
    • PDB 7BU6 (0-End)
    Domains in SCOPe 2.08: d7bu6b1, d7bu6b2, d7bu6b3
  • Heterogens: E5E, SO4, NA, EPE, 480, CLR, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >7bu6B (B:)
qvqlqesggglvqaggslrlscaasgsifalnimgwyrqapgkqrelvaaihsggttnya
nsvkgrftisrdnaantvylqmnslkpedtavyycnvkdfgaiiydydywgqgtqvtvss
lehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >7bu6B (B:)
qvqlqesggglvqaggslrlscaasgsifalnimgwyrqapgkqrelvaaihsggttnya
nsvkgrftisrdnaantvylqmnslkpedtavyycnvkdfgaiiydydywgqgtqvtvss