PDB entry 6xhd

View 6xhd on RCSB PDB site
Description: Structure of Prolinyl-5'-O-adenosine phosphoramidate
Class: RNA binding protein
Keywords: RNase A complex, amino acid release, prodrug, RNA BINDING PROTEIN
Deposited on 2020-06-18, released 2021-03-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-17, with a file datestamp of 2021-03-12.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease pancreatic
  Species: Bos taurus [TaxId:9913]
  Gene: RNASE1, RNS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
  Domains in SCOPe 2.08: d6xhda_
• Chain 'B':
  Compound: ribonuclease pancreatic
  Species: Bos taurus [TaxId:9913]
  Gene: RNASE1, RNS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61823 (0-123)
  Domains in SCOPe 2.08: d6xhdb_
• Heterogens: V2P, K, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6xhdA (A:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6xhdB (B:)
  ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
  knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
  dasv