PDB entry 6w7z

View 6w7z on RCSB PDB site
Description: RNF12 RING domain in complex with Ube2d2
Class: ligase
Keywords: RING E3 ligase, Ubiquitin, Ubiquitin conjugating enzyme, X-chromosome inactivation, RING, LIGASE
Deposited on 2020-03-19, released 2020-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-01, with a file datestamp of 2020-06-26.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2D2, PUBC1, UBC4, UBC5B, UBCH4, UBCH5B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62837 (5-151)
      • expression tag (3-4)
      • engineered mutation (25-26)
      • engineered mutation (111)
      • engineered mutation (115)
    Domains in SCOPe 2.08: d6w7za1, d6w7za2
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase RLIM
    Species: Homo sapiens [TaxId:9606]
    Gene: RLIM, RNF12
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6w7zA (A:)
gplgsmalkrihkelndlardppaqsragpvgddmfhwqatimgpndspyqggvffltih
fptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsissllsdpnp
ddplvpeiariyktdrekynriarewtqkyam

    Sequence, based on observed residues (ATOM records): (download) 
    >6w7zA (A:)
gsmalkrihkelndlardppaqsragpvgddmfhwqatimgpndspyqggvffltihfpt
dypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsissllsdpnpddp
lvpeiariyktdrekynriarewtqkyam

  • Chain 'B':
    No sequence available.