PDB entry 6upj

View 6upj on RCSB PDB site
Description: hiv-2 protease/u99294 complex
Class: hydrolase
Keywords: hydrolase, acid protease, hiv-2 protease-inhibitor complex, protein-substrate interaction, aspartyl protease
Deposited on 1996-12-10, released 1997-04-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.161
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-2 protease
    Species: Human immunodeficiency virus 2 [TaxId:11709]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04584 (0-98)
      • engineered (56)
    Domains in SCOPe 2.05: d6upja_
  • Chain 'B':
    Compound: hiv-2 protease
    Species: Human immunodeficiency virus 2 [TaxId:11709]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04584 (0-98)
      • engineered (56)
    Domains in SCOPe 2.05: d6upjb_
  • Heterogens: NIU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6upjA (A:)
    pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
    nveievlnkkvratimtgdtpinifgrniltalgmslnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6upjB (B:)
    pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
    nveievlnkkvratimtgdtpinifgrniltalgmslnl