PDB entry 6u0j

View 6u0j on RCSB PDB site
Description: Crosslinked Crystal Structure of Malonyl-CoA Acyl Carrier Protein Transacylase, FabD, and Acyl Carrier Protein, AcpP
Class: transferase
Keywords: MAT, AT, transferase, acyl transferase, alpha-beta hydrolase fold, AcpP, ACP, CP
Deposited on 2019-08-14, released 2020-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-14, with a file datestamp of 2020-10-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malonyl coa-acyl carrier protein transacylase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fabD, tfpA, b1092, JW1078
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AAI9 (3-End)
      • expression tag (2)
      • conflict (94)
  • Chain 'B':
    Compound: Acyl carrier protein
    Species: Escherichia coli (strain K12 / DH10B) [TaxId:316385]
    Gene: acpP, ECDH10B_1166
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6u0jb_
  • Heterogens: 9EF, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6u0jB (B:)
    mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
    ekittvqaaidyinghqashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u0jB (B:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyin