PDB entry 6mv7

View 6mv7 on RCSB PDB site
Description: Crystal structure of RNAse 6
Class: hydrolase
Keywords: rnase, nuclease, HYDROLASE
Deposited on 2018-10-24, released 2019-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease K6
  Species: Homo sapiens [TaxId:9606]
  Gene: RNASE6, RNS6
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q93091 (1-127)
    • initiating methionine (0)
  Domains in SCOPe 2.07: d6mv7a_
• Heterogens: AMP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6mv7A (A:)
  mwpkrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdlls
  ivcknrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklv
  pvhldsil