Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.0: automated matches [191478] (1 protein) not a true family |
Protein automated matches [190767] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255211] (6 PDB entries) |
Domain d6mv7a_: 6mv7 A: [376782] automated match to d4x09a_ complexed with amp |
PDB Entry: 6mv7 (more details), 2.59 Å
SCOPe Domain Sequences for d6mv7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mv7a_ d.5.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mwpkrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdlls ivcknrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklv pvhldsil
Timeline for d6mv7a_: