PDB entry 6jug

View 6jug on RCSB PDB site
Description: Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose
Class: hydrolase
Keywords: xylanase II, complex, Xylotriose, HYDROLASE
Deposited on 2019-04-13, released 2020-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-23, with a file datestamp of 2020-12-18.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Endo-1,4-beta-xylanase 2
  Species: Trichoderma reesei RUT C-30 [TaxId:1344414]
  Gene: xyn2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36217 (0-188)
    • engineered mutation (42)
    • engineered mutation (175)
  Domains in SCOPe 2.08: d6juga_
• Heterogens: IOD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jugA (A:)
  tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgefvggkgwqpgtknkvin
  fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
  rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavqgyfs
  sgsasitvs