PDB entry 6hpi

View 6hpi on RCSB PDB site
Description: NMR structure of the pro-inflammatory cytokine interleukin-36alpha
Class: cytokine
Keywords: protein interleukin-1 superfamily beta-trefoil heme-binding, cytokine
Deposited on 2018-09-21, released 2019-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin-36 alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL36A, FIL1E, IL1E, IL1F6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6hpia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6hpiA (A:)
mekalkidtpqqgsiqdinhrvwvlqdqtliavprkdrmspvtialiscrhvetlekdrg
npiylglnglnlclmcakvgdqptlqlkekdimdlynqpepvksflfyhsqsgrnstfes
vafpgwfiavsseggcpliltqelgkanttdfgltmlf