PDB entry 6fzu

View 6fzu on RCSB PDB site
Description: rorgt (264-518;c455s) in complex with the fragment ("cpd-1") and rip140 peptide at 1.80a
Class: transcription
Keywords: fbs, nuclear hormone receptor, ligand-binding domain, inverse agonist, signaling protein, transcription
Deposited on 2018-03-15, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (193)
    Domains in SCOPe 2.07: d6fzua_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (193)
    Domains in SCOPe 2.07: d6fzub_
  • Chain 'P':
    Compound: Nuclear receptor-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Nuclear receptor-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EE8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fzuA (A:)
    gpyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerca
    hhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegk
    yggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveq
    lqynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafppl
    ykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fzuA (A:)
    yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
    elfst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fzuB (B:)
    gpyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerca
    hhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegk
    yggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveq
    lqynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafppl
    ykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fzuB (B:)
    yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
    elfst
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.