PDB entry 6fqn

View 6fqn on RCSB PDB site
Description: Carbamylated T. californica acetylcholineterase bound to uncharged hybrid reactivator 2
Class: hydrolase
Keywords: Acetylcholinesterase Hybrid reactivators Organophosphate inhibition Structure-based optimization, hydrolase
Deposited on 2018-02-14, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Tetronarce californica [TaxId:7787]
    Gene: ACHE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fqna_
  • Heterogens: E2W, NAG, EDO, CL, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fqnA (A:)
    sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
    pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
    sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
    iqffggdpktvtifgexaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
    ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
    slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
    ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
    nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
    ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat