PDB entry 6fa2

View 6fa2 on RCSB PDB site
Description: Antibody derived (Abd-5) small molecule binding to KRAS.
Class: oncoprotein
Keywords: Abd-5, inhibitor, KRAS, ONCOPROTEIN
Deposited on 2017-12-15, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (0-166)
      • engineered mutation (60)
    Domains in SCOPe 2.07: d6fa2a_
  • Chain 'B':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (3-169)
      • expression tag (0-2)
      • engineered mutation (63)
    Domains in SCOPe 2.07: d6fa2b1, d6fa2b2
  • Chain 'C':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (4-170)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d6fa2c1, d6fa2c2
  • Chain 'D':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (3-169)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6fa2d1, d6fa2d2
  • Chain 'E':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (3-169)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6fa2e1, d6fa2e2
  • Chain 'F':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (3-169)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6fa2f1, d6fa2f2
  • Heterogens: MG, GNP, D2W, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fa2A (A:)
    mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
    heeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
    psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fa2B (B:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fa2B (B:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    taghesamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fa2C (C:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldil
    dtagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgn
    kcdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fa2C (C:)
    yfqgmteyklvvvgaggvgksaltiqliqnhfvdeydptdsyrkqvvidgetclldildt
    agsamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlps
    rtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fa2D (D:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fa2D (D:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydsyrkqvvidgetclldildtagrd
    qymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkq
    aqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fa2E (E:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fa2E (E:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagmrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsr
    tvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6fa2F (F:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldild
    tagheeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnk
    cdlpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fa2F (F:)
    fqgmteyklvvvgaggvgksaltiqliqnhfvdedsyrkqvvidgetclldildtagmrd
    qymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvdtkq
    aqdlarsygipfietsaktrqgvddafytlvreirkhk