PDB entry 6eih

View 6eih on RCSB PDB site
Description: The crystal structure of 14-3-3 epsilon in complex with the phosphorylated NELFE peptide
Class: protein binding
Keywords: 14-3-3, NELF, protein binding
Deposited on 2017-09-19, released 2018-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein epsilon
    Species: Homo sapiens [TaxId:9606]
    Gene: YWHAE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6eiha_
  • Chain 'P':
    Compound: ser-ile-sep-arg
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6EIH (0-3)
  • Heterogens: SEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6eihA (A:)
dredlvyqaklaeqaerydemvesmkkvagmdveltveernllsvayknvigarraswri
issieqkeenkggedklkmireyrqmvetelkliccdildvldkhlipaantgeskvfyy
kmkgdyhrylaefatgndrkeaaenslvaykaasdiamtelppthpirlglalnfsvfyy
eilnspdracrlakaafddaiaeldtlseesykdstlimqllrdnltlwt

  • Chain 'P':
    No sequence available.