PDB entry 6d7m

View 6d7m on RCSB PDB site
Description: Crystal structure of the W184R/W231R Importin alpha mutant
Class: transport protein
Keywords: importin, nls, bipartite, protein binding, transport protein
Deposited on 2018-04-25, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Peroxidase,Importin subunit alpha-1
    Species: Mus musculus [TaxId:10090]
    Gene: Kpna2, Rch1
    Database cross-references and differences (RAF-indexed):
    • PDB 6D7M
    • Uniprot P52293
      • engineered mutation (164)
      • engineered mutation (211)
    Domains in SCOPe 2.07: d6d7mb_
  • Heterogens: EDO, CL, SIN, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6d7mB (B:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamadigsnqgtvnwsve
    divkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdcspiqfe
    sawaltniasgtseqtkavvdggaipafisllasphahiseqavralgniagdgsafrdl
    vikhgaidpllallavpdlstlacgylrnltrtlsnlcrnknpappldaveqilptlvrl
    lhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpalraign
    ivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqvvnhglv
    pflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakdtkiiqv
    ildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnliekyfsve
    eeedqnvvpettsegfafqvqdgapgtfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6d7mB (B:)
    tvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktd
    cspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavralgniagd
    gsafrdlvikhgaidpllallavpdlstlacgylrnltrtlsnlcrnknpappldaveqi
    lptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtp
    alraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqq
    vvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsak
    dtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnli
    ekyf