PDB entry 6cpa

View 6cpa on RCSB PDB site
Description: crystal structure of the complex of carboxypeptidase a with a strongly bound phosphonate in a new crystalline form: comparison with structures of other complexes
Class: hydrolase (c-terminal peptidase)
Keywords: hydrolase (c-terminal peptidase)
Deposited on 1990-02-15, released 1991-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-306)
      • conflict (27)
      • conflict (30)
      • conflict (88)
      • conflict (92)
      • conflict (113)
      • conflict (121)
      • conflict (184)
      • conflict (227)
      • conflict (304)
    Domains in SCOPe 2.06: d6cpaa_
  • Heterogens: ZN, ZAF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6cpaA (A:)
    arstntfnyatyhtldeiydfmdllvaqhpelvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftenygqnpsftaildsmdifleivtnpngfafth
    senrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvknhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnn