PDB entry 6clz

View 6clz on RCSB PDB site
Description: MT1-MMP HPX domain with Blade 4 Loop Bound to Nanodiscs
Class: lipid binding protein
Keywords: MT1-MMP, MMP-14, Nanodisc, lipids, peripheral membrane protein, protease domain, LIPID BINDING PROTEIN
Deposited on 2018-03-02, released 2018-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-14
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6clza_
  • Chain 'B':
    Compound: apolipoprotein a-I
    Species: Homo sapiens [TaxId:9606]
    Gene: APOA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02647 (0-210)
      • insertion (44-65)
  • Chain 'C':
    Compound: apolipoprotein a-I
    Species: Homo sapiens [TaxId:9606]
    Gene: APOA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02647 (0-210)
      • insertion (44-65)
  • Heterogens: PX4, NA, CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6clzA (A:)
pnicdgnfdtvamlrgemfvfkerwfwrvrnnqvmdgypmpigqfwrglpasintayerk
dgkfvffkgdkhwvfdeaslepgypkhikelgrglptdkidaalfwmpngktyffrgnky
yrfneelravdseypknikvwegipesprgsfmgsdevftyfykgnkywkfnnqklkvep
gypksalrdwmgcpsg

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.