PDB entry 6bcb

View 6bcb on RCSB PDB site
Description: A Complex between PH Domain of p114RhoGEF and Activated RhoA Bound to a GTP Analog
Class: signaling protein
Keywords: Rho GTPase Guanine Nucleotide Exchange Factors RhoGEF Pleckstrin Homology PH domain, SIGNALING PROTEIN
Deposited on 2017-10-20, released 2017-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine nucleotide exchange factor 18
    Species: Mus musculus [TaxId:10090]
    Gene: Arhgef18, Kiaa0521
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P9R4 (3-145)
      • expression tag (0-2)
  • Chain 'F':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOA, ARH12, ARHA, RHO12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6bcbf_
  • Heterogens: GSP, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download) 
    >6bcbF (F:)
gildmaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvela
lwdtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvg
nkkdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematr
aalqa

    Sequence, based on observed residues (ATOM records): (download) 
    >6bcbF (F:)
maairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdt
agqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkd
lrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalq
a