PDB entry 5zkz

View 5zkz on RCSB PDB site
Description: Crystal Structures of Mutant Endo-beta-1,4-xylanase II(Y77F) Complexed with Xylotriose
Class: hydrolase
Keywords: xylanase II, complex, Co-crystallization, Xylotriose, HYDROLASE
Deposited on 2018-03-26, released 2019-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase 2
    Species: Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) [TaxId:1344414]
    Gene: xyn2, M419DRAFT_124931
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36217 (0-188)
      • engineered mutation (75)
    Domains in SCOPe 2.08: d5zkza_
  • Heterogens: GOL, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zkzA (A:)
    tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
    fsgsynpngnsylsvfgwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
    rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
    sgsasitvs