PDB entry 5zkz

View 5zkz on RCSB PDB site
Description: Crystal Structures of Mutant Endo-beta-1,4-xylanase II(Y77F) Complexed with Xylotriose
Class: hydrolase
Keywords: xylanase II, complex, Co-crystallization, Xylotriose, HYDROLASE
Deposited on 2018-03-26, released 2019-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Endo-1,4-beta-xylanase 2
  Species: Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) [TaxId:1344414]
  Gene: xyn2, M419DRAFT_124931
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36217 (0-188)
    • engineered mutation (75)
  Domains in SCOPe 2.08: d5zkza_
• Heterogens: GOL, IOD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5zkzA (A:)
  tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
  fsgsynpngnsylsvfgwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
  rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
  sgsasitvs