PDB entry 5z1c

View 5z1c on RCSB PDB site
Description: The crystal structure of uPA in complex with 4-Iodobenzylamine at pH7.4
Class: hydrolase
Keywords: halogen bonding, serine protease, uPA, P1 group, protease inhibitor, HYDROLASE
Deposited on 2017-12-25, released 2018-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'U':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-244)
      • engineered mutation (120)
      • engineered mutation (143)
    Domains in SCOPe 2.08: d5z1cu_
  • Heterogens: ZXI, HOH

PDB Chain Sequences:

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5z1cU (U:)
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irsht