PDB entry 5z0s

View 5z0s on RCSB PDB site
Description: Crystal structure of FGFR1 kinase domain in complex with a novel inhibitor
Class: transferase/transferase inhibitor
Keywords: FGFR1 inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-12-20, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (30)
    Domains in SCOPe 2.07: d5z0sa_
  • Chain 'B':
    Compound: fibroblast growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR1, BFGFR, CEK, FGFBR, FLG, FLT2, HBGFR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11362
      • engineered mutation (30)
    Domains in SCOPe 2.07: d5z0sb_
  • Heterogens: 960, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5z0sA (A:)
    agvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlk
    sdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarr
    ppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvm
    kiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlg
    gspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldri
    valtsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z0sA (A:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaigldkpnrvtkvavkmlksdatekdl
    sdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeqlss
    kdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyykkt
    tngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkegh
    rmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5z0sB (B:)
    agvseyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlk
    sdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarr
    ppgleysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvm
    kiadfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlg
    gspypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldri
    valtsnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5z0sB (B:)
    elpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekdlsd
    lisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeqlsskd
    lvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardhhidyykkttng
    rlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmd
    kpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalt