PDB entry 5yl3

View 5yl3 on RCSB PDB site
Description: Crystal structure of horse heart myoglobin reconstituted with manganese porphycene in resting state at pH 8.5
Class: oxygen storage
Keywords: globin fold, oxygen transport, muscles, oxygen storage
Deposited on 2017-10-17, released 2017-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5yl3a_
  • Heterogens: HNN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yl3A (A:)
    mglsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkase
    dlkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskh
    pgdfgadaqgamtkalelfrndiaakykelgfqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yl3A (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgf