PDB entry 5y5q

View 5y5q on RCSB PDB site
Description: Crystal structure of the WSSV dUTPase D88N/R158E mutant in complex with dUTP
Class: viral protein
Keywords: dUTPase, WSSV, pyrophosphatase, dUTP, VIRAL PROTEIN
Deposited on 2017-08-09, released 2017-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Wsv112
    Species: White spot syndrome virus (isolate Shrimp/China/Tongan/1996) [TaxId:654913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q77J78
      • engineered mutation (90)
    Domains in SCOPe 2.06: d5y5qa_
  • Chain 'B':
    Compound: Wsv112
    Species: White spot syndrome virus (isolate Shrimp/China/Tongan/1996) [TaxId:654913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q77J78
      • engineered mutation (90)
      • engineered mutation (160)
  • Chain 'C':
    Compound: Wsv112
    Species: White spot syndrome virus (isolate Shrimp/China/Tongan/1996) [TaxId:654913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q77J78
      • engineered mutation (90)
  • Heterogens: DUT, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5y5qA (A:)
snamdssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygi
dkfpdgcygqivsrsgmtwknntsvptgtinvdyrgelkvilrnhsaeksvpirkgtsia
qliflrycdveeeqivyinettgertiidssskkdnknqaesvrgtggfgstdn

    Sequence, based on observed residues (ATOM records): (download) 
    >5y5qA (A:)
ssasvvfmrfappgeetalpprratpgsvaydlfpseemdiepmglakistgygidkfpd
gcygqivsrsgmtwknntsvptgtinvdyrgelkvilrnhsaeksvpirkgtsiaqlifl
rycdveeeqivyinettgertiidsssk

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.