PDB entry 5xly

View 5xly on RCSB PDB site
Description: Crystal structure of CheR1 in complex with c-di-GMP-bound MapZ
Class: transferase
Keywords: signaling, methyltransferase, TRANSFERASE
Deposited on 2017-05-12, released 2017-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein methyltransferase 1
  Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
  Gene: cheR1, PA3348
  Database cross-references and differences (RAF-indexed):
  • Uniprot O87131 (Start-273)
• Chain 'B':
  Compound: Cyclic diguanosine monophosphate-binding protein PA4608
  Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
  Gene: PA4608
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HVI1
  Domains in SCOPe 2.08: d5xlyb_
• Heterogens: C2E, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >5xlyB (B:)
  msdqhderrrfhriafdadseilqgerrwevllhdvslhgilvgqpqdwngdpqrpfear
  lylgldvlirmeislawardgllgfecqhidldsishlrrlvelnlgdeellerelallv
  sahddlehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5xlyB (B:)
  qhderrrfhriafdadseilqgerrwevllhdvslhgilvgqpqdwngdpqrpfearlyl
  gldvlirmeislawardgllgfecqhidldsishlrrlvelnlgdeellerelallvsah
  d