PDB entry 5wtw

View 5wtw on RCSB PDB site
Description: Hepatitis B virus core protein Y132A mutant in P 41 21 2 Space Group
Class: viral protein
Keywords: hepatitis b virus, hbv, core protein, capsid, y132a dimer, y132a hexamer, viral protein
Deposited on 2016-12-15, released 2017-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Core protein
    Species: Hepatitis B virus [TaxId:10407]
    Database cross-references and differences (RAF-indexed):
    • Uniprot L7R9I1 (0-141)
      • engineered mutation (131)
    Domains in SCOPe 2.06: d5wtwa_
  • Chain 'B':
    Compound: Core protein
    Species: Hepatitis B virus [TaxId:10407]
    Database cross-references and differences (RAF-indexed):
    • Uniprot L7R9I1 (0-141)
      • engineered mutation (131)
    Domains in SCOPe 2.06: d5wtwb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5wtwA (A:)
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilst

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5wtwB (B:)
mdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehcsphhtalrqail
cwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhiscltfgretvleylv
sfgvwirtppaarppnapilst