PDB entry 5w72

View 5w72 on RCSB PDB site
Description: Impact of IR active probes on PDZ3 and its ligand binding studied by NMR and X-ray crystallography
Class: signaling protein
Keywords: Signaling protein
Deposited on 2017-06-19, released 2017-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: DLG4, DLGH4, PSD95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31016 (0-101)
      • conflict (0)
      • conflict (27)
      • conflict (40)
    Domains in SCOPe 2.08: d5w72a_
  • Heterogens: AZH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w72A (A:)
    flgeedipreprrivihrgstglgfniiggedgegifisfxlaggpadlsgelrkgdqil
    svngvdlrnasheqaaialknagqtvtiiaqykpeeysrfea