PDB entry 5ut7

View 5ut7 on RCSB PDB site
Description: Wild-type sperm whale myoglobin with nitrite
Class: oxygen transport
Keywords: Heme, Myoglobin, Nitrite, Nitrosyl, Nitric oxide, Hydrophilic orientation, OXYGEN TRANSPORT
Deposited on 2017-02-14, released 2018-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-153)
    • variant (122)
  Domains in SCOPe 2.08: d5ut7a_
• Heterogens: HEM, NO2, SO4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ut7A (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg