PDB entry 5upj

View 5upj on RCSB PDB site
Description: hiv-2 protease/u99283 complex
Class: hydrolase
Keywords: hydrolase, acid protease, hiv-2 protease-inhibitor complex, protein-substrate interaction, aspartyl protease
Deposited on 1996-12-10, released 1997-04-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-2 protease
  Species: Human immunodeficiency virus 2 [TaxId:11709]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04584 (0-98)
    • engineered (56)
  Domains in SCOPe 2.05: d5upja_
• Chain 'B':
  Compound: hiv-2 protease
  Species: Human immunodeficiency virus 2 [TaxId:11709]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04584 (0-98)
    • engineered (56)
  Domains in SCOPe 2.05: d5upjb_
• Heterogens: UIN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5upjA (A:)
  pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
  nveievlnkkvratimtgdtpinifgrniltalgmslnl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5upjB (B:)
  pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
  nveievlnkkvratimtgdtpinifgrniltalgmslnl