PDB entry 5ue5

View 5ue5 on RCSB PDB site
Description: proMMP-7 with heparin octasaccharide bound to the catalytic domain
Class: hydrolase
Keywords: glycan complex with protein, enzyme complex with heparin oligosaccharide, zymogen, allosteric effector site, HYDROLASE
Deposited on 2016-12-29, released 2017-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrilysin
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP7, MPSL1, PUMP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09237 (0-246)
      • conflict (194)
    Domains in SCOPe 2.08: d5ue5a1, d5ue5a2
  • Heterogens: CA, ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ue5A (A:)
pqeaggmselqweqaqdylkrfylydsetknansleaklkemqkffglpitgmlnsrvie
imqkprcgvpdvaeyslfpnspkwtskvvtyrivsytrdlphitvdrlvskalnmwgkei
plhfrkvvwgtadimigfargahgdsypfdgpgntlahafapgtglggdahfdederwtd
gsslginflyaathalghslgmghssdpnavmyptygngdpqnfklsqddikgiqklygk
rsnsrkk