PDB entry 5tw0

View 5tw0 on RCSB PDB site
Description: Structure of Pfp1 protease from Thermococcus thioreducens: small cell H3 crystal form
Class: hydrolase
Keywords: protease, hexamer, thermophile, noncrystallographic symmetry, HYDROLASE
Deposited on 2016-11-10, released 2017-09-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidase
    Species: Thermococcus thioreducens [TaxId:277988]
    Gene: AMR53_10535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tw0a_
  • Chain 'B':
    Compound: Peptidase
    Species: Thermococcus thioreducens [TaxId:277988]
    Gene: AMR53_10535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5tw0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5tw0A (A:)
mkvlflsadgfedlelicplhrikeeghevyvasfergkitgkhgysvnvdlafeevgpd
efdalvlpggrapeivrlnekaieitrkmfeagkpvasichgpqilisagvlkgrkgtst
itirddvvnagaewvneevvvdgnwvssrhpgdlyawmrefvkllk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5tw0B (B:)
mkvlflsadgfedlelicplhrikeeghevyvasfergkitgkhgysvnvdlafeevgpd
efdalvlpggrapeivrlnekaieitrkmfeagkpvasichgpqilisagvlkgrkgtst
itirddvvnagaewvneevvvdgnwvssrhpgdlyawmrefvkllk