PDB entry 5ok1

View 5ok1 on RCSB PDB site
Description: D10N variant of beta-phosphoglucomutase from Lactococcus lactis trapped with native beta-glucose 1,6-bisphosphate intermediate to 1.9A resolution.
Class: isomerase
Keywords: isomerase, phosphoglucomutase, bisphospho-intermediate
Deposited on 2017-07-25, released 2018-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene: pgmB, LL0429, L0001
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71447 (0-217)
      • engineered mutation (9)
      • engineered mutation (124)
      • engineered mutation (205)
    Domains in SCOPe 2.08: d5ok1a_
  • Heterogens: B16, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5ok1A (A:)
mfkavlfdlngvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
sgalpigvgrpedlgddivivpdtshytleflkevwlq