PDB entry 5o2v

View 5o2v on RCSB PDB site
Description: NMR structure of TIA-1 RRM1 domain
Class: RNA binding protein
Keywords: RRM, TIA-1, RNA binding protein
Deposited on 2017-05-22, released 2017-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleolysin TIA-1 isoform p40
    Species: Homo sapiens [TaxId:9606]
    Gene: Tia1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5o2va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5o2vA (A:)
medempktlyvgnlsrdvtealilqlfsqigpcknckmimdtagndpycfvefhehrhaa
aalaamngrkimgkevkvnwattpssqkkdts