PDB entry 5ms2

View 5ms2 on RCSB PDB site
Description: Crystal structure of the Legionella pneumophila effector protein RavZ in complex with human LC3B
Class: hydrolase
Keywords: Hydrolase, Autophagy, Host-pathogen interaction
Deposited on 2016-12-30, released 2017-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Legionella pneumophila effector protein RavZ
  Species: Legionella pneumophila subsp. pneumophila str. Philadelphia 1 [TaxId:272624]
  Gene: lpg1683
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5ZUV9
• Chain 'B':
  Compound: Microtubule-associated proteins 1A/1B light chain 3B
  Species: Homo sapiens [TaxId:9606]
  Gene: MAP1LC3B, MAP1ALC3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9GZQ8 (Start-123)
  Domains in SCOPe 2.06: d5ms2b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >5ms2B (B:)
  ghmgcmpsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkflvp
  dhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvyas
  qetf
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5ms2B (B:)
  ktfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmseli
  kiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvyasqetf