PDB entry 5jyv

View 5jyv on RCSB PDB site
Description: NMR structure of foldswitch-stablized KaiB in complex with pseudo receiver domain of CikA from Thermosynechococcus elongatus
Class: Sigaling protein
Keywords: Circadian Clock, Signaling protein complex, Sigaling protein
Deposited on 2016-05-15, released 2017-03-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Two-component sensor histidine kinase
    Species: Thermosynechococcus elongatus (strain BP-1) [TaxId:197221]
    Gene: tll0899
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Circadian clock protein kaiB
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Gene: kaiB, tlr0482
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79V61 (0-98)
      • engineered mutation (7)
      • engineered mutation (28)
      • engineered mutation (88)
      • engineered mutation (90)
      • engineered mutation (93)
      • expression tag (99-105)
    Domains in SCOPe 2.08: d5jyvb1, d5jyvb2

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5jyvB (B:)
maplrktavlklyvagntpnsvralktlanilekefkgvyalkvidvlknpqlaeedkil
atptlakvlpppvrriigdlsnrekvlialrllaeeigdykddddk