PDB entry 5jfu

View 5jfu on RCSB PDB site
Description: HIV-1 wild Type protease with GRL-007-14A (a Adamantane P1-Ligand with bis-THF in P2 and benzylamine in P1')
Class: hydrolase/hydrolase inhibitor
Keywords: Adamantane, HIV-1 protease inhibitor GRL-007-14A, darunavir, multidrug-resistant, hydrolase-hydrolase inhibitor complex
Deposited on 2016-04-19, released 2016-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot C8B467 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d5jfua_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot C8B467 (0-98)
    • engineered mutation (6)
    • engineered mutation (32)
    • engineered mutation (62)
    • engineered mutation (66)
    • engineered mutation (94)
  Domains in SCOPe 2.08: d5jfub_
• Heterogens: CL, 6KQ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5jfuA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5jfuB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf