PDB entry 5j76

View 5j76 on RCSB PDB site
Description: Structure of Lectin from Colocasia esculenta(L.) Schott
Class: sugar binding protein
Keywords: Sugar Binding, Lectin, Colocasia agglutinin, SUGAR BINDING PROTEIN
Deposited on 2016-04-06, released 2016-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 12kD storage protein
  Species: Colocasia esculenta [TaxId:4460]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q39487 (0-108)
    • conflict (57)
    • conflict (74)
    • conflict (86)
    • conflict (96)
    • conflict (105)
  Domains in SCOPe 2.08: d5j76a_
• Chain 'B':
  Compound: 12kD storage protein
  Species: Colocasia esculenta [TaxId:4460]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q39487 (0-110)
    • conflict (68)
    • conflict (80)
    • conflict (96)
  Domains in SCOPe 2.08: d5j76b_
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5j76A (A:)
  lgtnyllsgqtleteghlkngdfdlvmqddcnlvlyngnwqsntankgrdckltltdyge
  lvinngdgstvwrskaqsvkgdyaavdhpegrlvvfgpsvfkidpwvpg
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5j76B (B:)
  nipftnnllfsgqvlygdgrltaknhqlvmqgdcnlvlyggkygwqsnthgngehcflrl
  nhkgeliikdddfktiwsssssskqgdyvlilrddgfaviygpaiwetspq