PDB entry 5hrj
View 5hrj on RCSB PDB site
Description: Crystal structure of the scavenger receptor cysteine-rich domain 5 (SRCR5) from porcine CD163
Class: endocytosis
Keywords: cd163, srcr, prrsv, balbes nmr, endocytosis
Deposited on
2016-01-23, released
2017-07-19
The last revision prior to the SCOPe 2.06 freeze date was dated
2017-07-19, with a file datestamp of
2017-07-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Scavenger receptor cysteine-rich type 1 protein M130
Species: Sus scrofa [TaxId:9823]
Gene: CD163, M130
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5hrja_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>5hrjA (A:)
prlvggdipcsgrvevqhgdtwgtvcdsdfsleaasvlcrelqcgtvvsllggahfgegs
gqiwaeefqcegheshlslcpvaprpdgtcshsrdvgvvcsvdhhhhhh
Sequence, based on observed residues (ATOM records): (download)
>5hrjA (A:)
prlvggdipcsgrvevqhgdtwgtvcdsdfsleaasvlcrelqcgtvvsllggahfgegs
gqiwaeefqcegheshlslcpvaprpdgtcshsrdvgvvcs