PDB entry 5go0

View 5go0 on RCSB PDB site
Description: Solution structure of nedd8 from Trypanosoma brucei
Class: cell cycle
Keywords: ubiquitin-like fold, CELL CYCLE
Deposited on 2016-07-25, released 2017-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin, putative
    Species: Trypanosoma brucei brucei (strain 927/4 GUTat10.1) [TaxId:185431]
    Gene: Tb927.4.2540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5go0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5go0A (A:)
mghhhhhhmllkvktvsnkviqitsltddntiaelkgkleesegipgnmirlvyqgkqle
dekrlkdyqmsagatfhmvvalragc

    Sequence, based on observed residues (ATOM records): (download) 
    >5go0A (A:)
mllkvktvsnkviqitsltddntiaelkgkleesegipgnmirlvyqgkqledekrlkdy
qmsagatfhmvvalragc