PDB entry 5fnx

View 5fnx on RCSB PDB site
Description: Crystal structure at pH 9.0 of a potato STI-Kunitz bi-functional inhibitor of serine and aspartic proteases in space group p4322 and ph 9.0
Class: hydrolase inhibitor
Keywords: hydrolase, sti-kunitz inhibitor, aspartic proteases, serine proteases, protease inhibitor, bi-functional protease inhibitor, hydrolase inhibitor, kunitz-type inhibitor
Deposited on 2015-11-16, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: potato sti-kunitz bi-functional inhibitor e3ad_n19d
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed):
    • PDB 5FNX (Start-186)
    Domains in SCOPe 2.07: d5fnxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fnxA (A:)
    esplpkpvldtngkelnpdssyriisigrgalggdvylgkspnsdapcpdgvfrynsdvg
    psgtpvrfiplstnifedqllniqfniptvklcvsytiwkvgnlnayfrtmlletggtig
    qadnsyfkivksskigynllscpftsiiclrcpedqfcakvgvviqngkrrlalvnknpl
    dvlfqev
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fnxA (A:)
    plpkpvldtngkelnpdssyriisigrgalggdvylgkspnsdapcpdgvfrynsdvgps
    gtpvrfiplstnifedqllniqfniptvklcvsytiwkvgnlnayfrtmlletggtigqa
    dnsyfkivksskigynllscpftsiiclrcpedqfcakvgvviqngkrrlalvnknpldv
    lfqev