PDB entry 5fbf

View 5fbf on RCSB PDB site
Description: S1 nuclease from Aspergillus oryzae in complex with two molecules of 2'-deoxycytidine-5'-monophosphate
Class: hydrolase
Keywords: Endonuclease, Zinc dependent, Complex, hydrolase
Deposited on 2015-12-14, released 2016-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclease S1
    Species: Aspergillus oryzae RIB40 [TaxId:510516]
    Gene: nucS, AO090001000075
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5fbfa_
  • Heterogens: ZN, NAG, DCM, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5fbfA (A:)
    wgnlghetvayiaqsfvasstesfcqnilgddstsylanvatwadtykytdagefskpyh
    fidaqdnppqscgvdydrdcgsagcsisaiqnytnillespngsealnalkfvvhiigdi
    hqplhdenleaggngidvtydgettnlhhiwdtnmpeeaaggyslsvaktyadllterik
    tgtysskkdswtdgidikdpvstsmiwaadantyvcstvlddglayinstdlsgeyydks
    qpvfeeliakagyrlaawldliasqps