PDB entry 5f5y

View 5f5y on RCSB PDB site
Description: WT Drosophila Melanogaster Cycle PAS-B with Bound Ethylene Glycol
Class: circadian clock protein
Keywords: PAS, Ethylene Glycol, Clock, BMAL, CIRCADIAN CLOCK PROTEIN
Deposited on 2015-12-04, released 2016-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein cycle
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: cyc, CG8727
    Database cross-references and differences (RAF-indexed):
    • Uniprot O61734 (1-102)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d5f5ya_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5f5yA (A:)
mfisrhsgegkflfidqratlvigflpqeilgtsfyeyfhnediaalmeshkmvmqvpek
vttqvyrfrckdnsyiqlqsewrafknpwtseidyiiaknsvf