PDB entry 5eu2

View 5eu2 on RCSB PDB site
Description: Crystal structure of murine neuroglobin mutant V101F at ambient pressure
Class: transport protein
Keywords: globin, oxygen storage-transporter, transport protein
Deposited on 2015-11-18, released 2016-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuroglobin
    Species: Mus musculus [TaxId:10090]
    Gene: NGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ER97 (0-147)
      • engineered mutation (52)
      • engineered mutation (98)
      • engineered mutation (117)
    Domains in SCOPe 2.06: d5eu2a_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5eu2A (A:)
    rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
    dhirkvmlvidaavtnvedlssleeyltslgrkhravgfrlssfstvgesllymlekslg
    pdftpatrtawsrlygavvqamsrgwdg