PDB entry 5ekw

View 5ekw on RCSB PDB site
Description: A. thaliana IGPD2 in complex with the racemate of the triazole-phosphonate inhibitor, C348
Class: lyase
Keywords: Herbicide development, Histidine biosynthesis, Inhibitor complex, Dehydratase, LYASE
Deposited on 2015-11-04, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HISN5B, At4g14910, dl3495c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ekwa1, d5ekwa2
  • Heterogens: MN, 5DL, 5LD, EDO, TRS, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ekwA (A:)
    maspiesarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhv
    ratgdthiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrp
    ylgynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafara
    lrqatesdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ekwA (A:)
    sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
    hiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynl
    eiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralrqate
    sdprrggtipsskg